BSV Intel the signal, daily
Edition 91
Monday · June 1, 2026
BSV Network · 24 hours ending June 1, 10:28 UTC

Edition 91

Edited by Bridget Doran · Scanned 10:35 UTC, June 1 · Blocks 951,492 → 951,635 · 2,115,135 transactions
Largest move
$1.00M
72,985 BSV · whale tier
Avg block time
10.5min
near schedule
Throughput
24tx/s
peak 430 tx/s
BSV price
$13.76
▼ 1.9% · 24h
№ 01 Chain Health

8 pools, on schedule

8 pools produced today's 144 blocks at an average interval of 10.5 min — on schedule relative to the 10-minute target.

7.3 min
Median interval
half the blocks faster
52
Fast blocks1
under 5 min
201,435 txs
Busiest block
block 951,571
Fast and slow blocks are an expected feature of Proof of Work, not a defect. Block timing follows a Poisson process (random spacing around a steady average), so clusters of fast or slow blocks happen even when hashrate is unchanged.
Block cadence · 144 blocks · 24.7h
Fast (<5 min) · 52 Normal · 68 Slow (>20 min) · 24
For the technical reader

Block timing. Mean interval 627.3 seconds (10.5 min) over 142 measured intervals across 144 blocks; median 437 seconds (7.3 min). Range 1 s to 3313 s (55.2 min). One sub-3-second interval observed.

Cadence. Average interval 10.5 min — on schedule relative to the 10-minute target. 8 pools produced today's blocks.

Largest block. Block 951,571 at 201,435 transactions, the peak load in the window. Avg tx/block across all 144 blocks was 14,688.

№ 02 Mining Distribution

8 pools produced today's 144 blocks

taal.com led at 22.9%. Distribution within normal range.

taal.com 22.9%
CUVVE 18.1%
SA100 15.3%
GorillaPool 15.3%
qdlnk 12.5%
Mining-Dutch 6.9%
molepool.com 4.2%
taal.com_Teranode 3.5%
For the technical reader

Pool identification is by coinbase signature; pools that don't sign or use unrecognized tags appear as untagged producers. The _Teranode suffix (e.g., taal.com_Teranode) marks blocks attributed to a pool running the Teranode node software — based on observable signals in the block data, not a formal protocol marker. GorillaPool.io may also be running a Teranode (observed in the Teranode explorer); when blocks become attributable to that node, they would appear with the suffix as well.

Block counts: taal.com 33, CUVVE 26, SA100 22, GorillaPool 22, qdlnk 18, Mining-Dutch 10, molepool.com 6, taal.com_Teranode 5. 142 of 144 blocks identified.

№ 03 Capital Flow

110 movements crossed the chain

3 of them moved more than 10,000 BSV, a combined ~$2.4 million at today's price.

3
Major
> 10K BSV
~$137,600+
6
Notable
1K – 10K BSV
~$13,760 – 137,600
101
Significant
100 – 1K BSV
~$1,376 – 13,760
Top movements
72,985.39BSV
≈ $1,004,279 b6c508a432…
2 → 2 Neutral
72,808.77BSV
≈ $1,001,849 1c2caec103…
2 → 2 Neutral
25,000.00BSV
≈ $344,000 1cdec1a87d…
1 → 2 Neutral
7,808.51BSV
≈ $107,445 35a68cb913…
1 → 2 Neutral
For the technical reader

Tier thresholds. Major > 10K BSV; Notable 1K – 10K BSV; Significant 100 – 1K BSV. Counts are unique transactions in the 24-hour window moving value within these bands; the 100-BSV floor excludes ordinary day-to-day payments.

Shape is input-count → output-count. Pattern is heuristic:

Neutral: typical payment shape (1→2 or 2→2, one payment + change).
Consolidation: many inputs, few outputs (UTXO cleanup or sweep).
Distribution: few inputs, many outputs (payouts, faucet, batch send).

№ 04 Address Intelligence

76 tracked addresses across 92 days

7 new addresses on the radar today. (what does this mean?)

New to the radar
1D4pnbN4QaDJo7CSnt… 72,985 BSV First appearance
1L6255TbcsBV2JNrpj… 72,809 BSV First appearance
1CULxdLf4VDYe1vAEG… 6,717 BSV First appearance
Recurring addresses
Address Behavior Confidence Active
4,653,526 BSV · 122 txs
Exchange-Like High 03-04 → 06-01
2,984,698 BSV · 98 txs
Exchange-Like High 03-02 → 05-25
10,188,658 BSV · 64 txs
Exchange-Like High 03-08 → 06-01
0 BSV · 63 txs
Accumulator High 03-08 → 06-01
6,287 BSV · 18 txs
Distributor Medium 04-13 → 05-13
How to read this

New to the radar flags addresses from today's top whale movements that have not appeared in any whale-tier transaction during the observation window. This could indicate a new large holder, a previously sub-threshold address crossing into whale territory, or a long-dormant address reactivating.

Recurring addresses are identified by tracking output scripts across all whale transactions (≥ 100 BSV) over the full 92-day observation window. An address appearing here has been involved in large-value movements on multiple separate days.

Behavior is based on whether an address predominantly receives (Accumulator), predominantly sends (Distributor), or does both in roughly equal measure (Exchange-Like).

Confidence reflects how many indicators align: transaction frequency, directional balance, and tier presence. High = 3+ indicators; Medium = 2; Low = 1.

All classifications are probabilistic. No identity or ownership claims are made. Addresses are derived from transaction output scripts.

№ 05 Throughput & Market
BSV / USD
$13.76
▼ 1.9% over 24h
Throughput, avg
24tx/s
peak 430 tx/s · 10-min window
Avg tx / block14,688
Max tx / block201,435
Total transactions2,115,135
10-min peak257,877
For the technical reader

TPS is computed over the 24.7 hours of the scan window in 10-minute intervals, not per block. The peak is the busiest 10-minute window observed (257,877 transactions, ≈ 430 tx/s for that window).

Price source: real-time quote at scan completion. 24h change is from a rolling 24-hour spot reference.

№ 06 Transaction Velocity

Activity by hour, across 27 hours

2,115,135 transactions mapped to 10-minute windows. The brightest cell is the busiest window of the day.

09121518210003060911:00:10:20:30:40:5009:00 UTC — 0 txs09:10 UTC — 0 txs09:20 UTC — 0 txs09:30 UTC — 0 txs09:40 UTC — 69,632 txs09:50 UTC — 23,558 txs10:00 UTC — 205 txs10:10 UTC — 252 txs10:20 UTC — 29 txs10:30 UTC — 0 txs10:40 UTC — 71 txs10:50 UTC — 137,965 txs138k11:00 UTC — 62,639 txs11:10 UTC — 129 txs11:20 UTC — 17 txs11:30 UTC — 0 txs11:40 UTC — 0 txs11:50 UTC — 236 txs12:00 UTC — 0 txs12:10 UTC — 0 txs12:20 UTC — 11,620 txs12:30 UTC — 0 txs12:40 UTC — 188,916 txs189k12:50 UTC — 0 txs13:00 UTC — 502 txs13:10 UTC — 178 txs13:20 UTC — 183 txs13:30 UTC — 225 txs13:40 UTC — 0 txs13:50 UTC — 360 txs14:00 UTC — 85 txs14:10 UTC — 114 txs14:20 UTC — 0 txs14:30 UTC — 162 txs14:40 UTC — 242 txs14:50 UTC — 280 txs15:00 UTC — 0 txs15:10 UTC — 0 txs15:20 UTC — 0 txs15:30 UTC — 16,530 txs15:40 UTC — 135,739 txs136k15:50 UTC — 422 txs16:00 UTC — 50,850 txs16:10 UTC — 43 txs16:20 UTC — 0 txs16:30 UTC — 0 txs16:40 UTC — 0 txs16:50 UTC — 0 txs17:00 UTC — 727 txs17:10 UTC — 314 txs17:20 UTC — 51 txs17:30 UTC — 28 txs17:40 UTC — 93 txs17:50 UTC — 27 txs18:00 UTC — 105,068 txs105k18:10 UTC — 95,039 txs18:20 UTC — 0 txs18:30 UTC — 0 txs18:40 UTC — 161 txs18:50 UTC — 62 txs19:00 UTC — 0 txs19:10 UTC — 0 txs19:20 UTC — 0 txs19:30 UTC — 0 txs19:40 UTC — 0 txs19:50 UTC — 1,381 txs20:00 UTC — 167 txs20:10 UTC — 33 txs20:20 UTC — 0 txs20:30 UTC — 471 txs20:40 UTC — 81 txs20:50 UTC — 88,131 txs21:00 UTC — 112,104 txs112k21:10 UTC — 0 txs21:20 UTC — 236 txs21:30 UTC — 0 txs21:40 UTC — 228 txs21:50 UTC — 4 txs22:00 UTC — 0 txs22:10 UTC — 0 txs22:20 UTC — 432 txs22:30 UTC — 113 txs22:40 UTC — 65 txs22:50 UTC — 72 txs23:00 UTC — 0 txs23:10 UTC — 142,669 txs143k23:20 UTC — 0 txs23:30 UTC — 257,877 txs258k23:40 UTC — 20 txs23:50 UTC — 0 txs00:00 UTC — 0 txs00:10 UTC — 0 txs00:20 UTC — 201,435 txs201k00:30 UTC — 158 txs00:40 UTC — 0 txs00:50 UTC — 0 txs01:00 UTC — 0 txs01:10 UTC — 186,299 txs186k01:20 UTC — 0 txs01:30 UTC — 14,186 txs01:40 UTC — 71 txs01:50 UTC — 94 txs02:00 UTC — 0 txs02:10 UTC — 310 txs02:20 UTC — 67 txs02:30 UTC — 61 txs02:40 UTC — 0 txs02:50 UTC — 178 txs03:00 UTC — 66 txs03:10 UTC — 65 txs03:20 UTC — 0 txs03:30 UTC — 157 txs03:40 UTC — 134 txs03:50 UTC — 0 txs04:00 UTC — 0 txs04:10 UTC — 10 txs04:20 UTC — 389 txs04:30 UTC — 36 txs04:40 UTC — 97 txs04:50 UTC — 0 txs05:00 UTC — 149 txs05:10 UTC — 49 txs05:20 UTC — 0 txs05:30 UTC — 0 txs05:40 UTC — 117 txs05:50 UTC — 63 txs06:00 UTC — 0 txs06:10 UTC — 2,048 txs06:20 UTC — 135,144 txs135k06:30 UTC — 0 txs06:40 UTC — 63,524 txs06:50 UTC — 146 txs07:00 UTC — 0 txs07:10 UTC — 290 txs07:20 UTC — 0 txs07:30 UTC — 937 txs07:40 UTC — 129 txs07:50 UTC — 0 txs08:00 UTC — 0 txs08:10 UTC — 238 txs08:20 UTC — 0 txs08:30 UTC — 0 txs08:40 UTC — 301 txs08:50 UTC — 65 txs09:00 UTC — 95 txs09:10 UTC — 196 txs09:20 UTC — 94 txs09:30 UTC — 83 txs09:40 UTC — 38 txs09:50 UTC — 0 txs10:00 UTC — 0 txs10:10 UTC — 641 txs10:20 UTC — 137 txs10:30 UTC — 0 txs10:40 UTC — 0 txs10:50 UTC — 0 txs11:00 UTC — 0 txs11:10 UTC — 0 txs11:20 UTC — 0 txs11:30 UTC — 0 txs11:40 UTC — 0 txs11:50 UTC — 0 txsActivity:High
Peak 10-min window: 257,877 txs Coverage: 144 blocks · 24.7h 05-31 09:43 UTC → 06-01 10:28 UTC
For the technical reader

Dark cells indicate 10-minute windows where no block was mined: a natural result of the Poisson process governing Proof of Work.2 Transactions broadcast during those windows appear in the next mined block.

Each row = one hour of the scan. Each column = a 10-minute bucket within that hour. Read left-to-right within a row, then down to the next hour.

Poisson process. A random event process where events occur independently at a stable average rate, but with unpredictable spacing. Block times have a 10-minute average but individual intervals scatter widely; that's not a bug, it's how the math works.
№ 07 On-chain Activity

4.3 million outputs, by purpose

The TxBlaster service produced 99.0% of transactions, posting paired payment and data-publication outputs continuously. The breakdown below isolates the remaining 1.0% so other activity is readable.

A note on storage. OP_RETURN data is prunable: nodes can discard it without breaking consensus, but reading it back requires running an indexer. UTXO-resident patterns (STAS tokens, spendable metadata, ordinal envelopes) remain in the chain's state and are recoverable from any pruned node. As BSV scales, the architectural direction is toward UTXO-resident data, not OP_RETURN.
All transactions, by source
TxBlaster · 99.0%
1.0%
2,092,990 tx 22,145 tx · all other
Excluding TxBlaster3 · 104,578 outputs
Payment 50.7% 53,028
P2PKH 48,017 · P2PK 5,000 · Multisig 11
Data Publication 16.2% 16,948
OP_RETURN 16,594 · Ordinal envelopes 278 · Spendable metadata 76
Contracts & Tokens 33.09% 34,602
STAS Gen 3: 108 · Custom locking: 34,494 · 6 unique structures

Of 51,550 non-payment outputs in this window, 32.2% were prunable (OP_RETURN) and 67.8% were UTXO-resident. Pruning is permitted by consensus today but not generally practiced — the architectural advantage of UTXO-resident data materializes as throughput scales toward Teranode-class capacity.

Method · how non-payment outputs are embedded
OP_RETURN 16,594Spendable metadata 76Ordinal envelope 278STAS Gen 3 108Custom locking 34,494
TxBlaster is an identified, automated service that posts paired P2PK + OP_RETURN transactions continuously. We count it separately not because it's less legitimate (every fee-paid valid transaction is real chain activity), but because at 99% of transaction count today, it would visually overwhelm everything else. The numbers above show what the other activity looks like.
For the technical reader

Purpose classifies outputs by what they're locked to:

Payment: P2PKH, P2PK, multisig (spendable value).
Data Publication: OP_RETURN, ordinal envelopes, spendable metadata (carrying data).
Contracts: STAS tokens, custom locking scripts (programmable spend conditions).

Spendable metadata (heuristic): scripts with signature verification followed by data removed via OP_DROP. Metadata isn't consumed by validation logic but remains on-chain in the UTXO set.

Unique structures: a contract structure is a normalized script skeleton with variable data (hashes, signatures, pubkeys) removed. 6 unique structures observed today across 34,602 contract outputs.

№ 08 Protocols & Content

What people published, and how it was framed

Open standards used to format data on-chain, and the MIME types declared in those publications.

Protocol · open standards defining data format
MAP 1,758Metanet4 1,386B:// 1,287AIP 6131Sat-Ordinal 275BSV-21 166STAS 13BAP 1
Metanet (the original). The 2018-2019 nChain protocol: a 4-byte "meta" push in OP_RETURN that defines a DAG of parent-txid-linked records. Not to be confused with the newer BRC-100 "Metanet" wallet/overlay ecosystem, which uses the same word for a different thing.
Content Type · MIME types in declared inscriptions
text/markdown 612text/plain 565application/bsv-20 166image/jpeg 74application/json 64image/webp 38image/png 37text/html 36
For the technical reader

Content Types are MIME declarations sourced from two structures: ordinal envelopes (1Sat-style spendable inscriptions) and B:// protocol OP_RETURN publications. Outputs that don't declare a MIME type aren't counted here.

application/bsv-20 covers both BSV-20 and BSV-21: both protocols declare "p":"bsv-20" in their JSON and most inscriptions inherit the legacy MIME type. Protocol differentiation happens via JSON fields (tick = BSV-20 ticker mode; sym/id = BSV-21 tickerless mode).

№ 09 Overlay Directory

225 endpoints across the federation, 4 new this window

BRC-88 topic registrations announce who is hosting which overlay services on chain.

SHIP · intake side
116endpoints
across 71 topics
SLAP · query side
109endpoints
across 66 topics
Top topic managers · SHIP (of 71)
tm_plite 15tm_template 14tm_uhrp 10tm_users 9tm_zed 8
Top lookup services · SLAP (of 66)
ls_template 13ls_plite 10ls_uhrp 9ls_users 8ls_identity 7
Directory topics tm_ship (27) · tm_slap (27) · ls_ship (26) · ls_slap (26)
New this window · 4 advertisements
SLAP
ls_meter
operator 03a356f4373c8c4a… · backend.161a4f0f091010a0f8a34a5d1d1b9dd7.projects.babbage.systems
951,521
SLAP
ls_meter
operator 03a356f4373c8c4a… · backend.161a4f0f091010a0f8a34a5d1d1b9dd7.projects.babbage.systems
951,525
SLAP
ls_identity
operator 03174a978bf337e3… · backend.f8ad4f88d28eff5fd4ab1411e2520a31.projects.babbage.systems
951,527
SLAP
ls_meter
operator 03a356f4373c8c4a… · backend.161a4f0f091010a0f8a34a5d1d1b9dd7.projects.babbage.systems
951,536
For the technical reader

BRC-88 SHIP/SLAP. Topic registrations on chain that announce which overlay services a node hosts. SHIP is the intake side (which topics this node accepts); SLAP is the query side (which topics this node can answer for).

endpoints = unique (URL, identity key) pairs. advertisements = signed unspent UTXOs on chain, each declaring one endpoint hosts one topic. topics = named overlay services like tm_uhrp or ls_ship.

Snapshot from 2026-06-01 11:15 UTC. Counts come from the four trackers hardcoded into the BSV SDK (overlay-us-1, overlay-eu-1, overlay-ap-1, users.bapp.dev). BSV apps query these to find which servers host the overlay topics they need.

№ 10 Identifiable Activity

Applications and tokens with recognizable fingerprints

GaiaLog led identifiable activity at 5,828 transactions. Most chain activity carries no such identifier; the names below are services whose on-chain shape is recognizable from prior analysis.

GaiaLog 5,828TreeChat 1,555dxs 4473D Ordi 121MNEE 63mintBlue 32OYO 27BSV Live Master 27memo.cash 22BSV Feed/View 22Indelible 19Neucron 8ForgeChain 6CASHEIO 2
Application Token Media / NFT
For the technical reader

Patterns are matched against a curated catalog of known protocols and application signatures: MAP tags, B:// envelopes, AIP, OPUB, ordinal mime declarations, custom STAS structures. Some come from WoC tags; others are identified through analysis. New patterns are added editorially as they emerge.

Counts are unique transactions touching each application's recognizable structures. A transaction can match more than one pattern.

№ 10 Script of the Day

Programmable Contract

CONTRACT · selected from 34,494 candidates

Programmable Contract with a 478-byte payload

What it does. This script uses conditional logic (OP_IF/OP_ELSE), byte manipulation (OP_SPLIT/OP_CAT), or hash operations to enforce spending conditions beyond simple signature verification.

Why it matters. Demonstrates BSV's full scripting capability for programmable money and stateful applications.

TX 9e6f7c3c15… Block 951,499 478 script bytes
Opcodes used (top 16 of 39)
DUP0NUMEQUALIFDROPCODESEPARATOR8ROLLCHECKSIGVERIFYVERIFYSPLITNIPSIZESUBBIN2NUM10
Script preview
OP_DUP OP_0 OP_NUMEQUAL OP_IF OP_DROP OP_DUP OP_CODESEPARATOR OP_8 OP_ROLL 0279be667ef9dcbbac55a06295ce870b07029bfcdb2dce28d959f2815b16f81798 OP_CHECKSIGVERIFY OP_VERIFY OP_DUP 68 OP_SPLIT OP_NIP OP_SIZE 2c OP_SUB OP_SPLIT OP_DROP OP_SIZE OP_8 OP_SUB OP_SPLIT OP_DROP OP_SIZE 29 OP_SUB OP_SPLIT OP_NI
Skeleton
OP_DUP OP_0 OP_NUMEQUAL OP_IF OP_DROP OP_DUP OP_CODESEPARATOR OP_8 OP_ROLL <DATA> OP_CHECKSIGVERIFY OP_VERIFY OP_DUP 68 OP_SPLIT OP_NIP OP_SIZE 2c OP_SUB OP_SPLIT OP_DROP OP_SIZE OP_8 OP_SUB OP_SPLIT
For the technical reader

Selection is editorial: one script per day from a curated category (Data Carrier, Token Mint, Complex Contract, Hash Puzzle, etc.). Candidate count shows how many similar scripts appeared in the same window.

The script preview above is the actual on-chain ASM (truncated for display); the skeleton normalizes pushes to <DATA> for pattern comparison across transactions. Opcodes shown are the unique ones present in the script, not the sequence order.

Support BSV Intel
Every classification in this brief came from a query I wrote, on infrastructure I built. If it's useful to you, sats keep it shipping.
HandCash $bridget33
BSV address 177bRhNJAioCgMyYCaKTJpauXpgHnUfWnK
Telegram @bsvintel_bot
send /subscribe for daily updates